PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG005571t1
Common NameTCM_005571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family GRAS
Protein Properties Length: 731aa    MW: 79449.9 Da    PI: 5.3562
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG005571t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS341.61.3e-1043727292374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL+++Ae +++g+l laq +Larl+++ sp g+p+ R+a+yf+eAL+  l         + ++s+ s++n++ ++ a+k fse+sPi++f+
  Thecc1EG005571t1 372 IDLLIQAAELIETGNLVLAQGILARLNHQLSPVGKPFIRAAFYFKEALQLLLRL-----NTTNNTSALSTYNMIFKIGAYKSFSEISPIVQFA 459
                       789*********************************************998875.....6667889999999********************* PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                       ++t+Nqa+le +eg++r+HiiDfdi++G+QW++L+q+L  R++g+psl+iT+++sp+++++ el  t+++L++fA+e+++ fe++ +  ++l+
  Thecc1EG005571t1 460 NFTCNQALLEVFEGCSRIHIIDFDIGYGGQWASLMQELVLRNGGAPSLKITAFSSPSTHDELELGFTQDNLKHFASEINMAFEIERMSLEALS 552
                       **************************************************************************************8666666 PP

              GRAS 188 dl.eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       +   +  L++ ++Ea+aVnl +  ++ +      +s+ + vL++vk+lsPk+vv  ++ +d+++ sF +++++al+ ys l++sl+a    + 
  Thecc1EG005571t1 553 SGsWPLPLHLPENEAIAVNLPIGCFSNY------PSTLPLVLRFVKQLSPKIVVSLDRGCDRTDVSFPHHVVHALQSYSGLLESLDAV-NMNL 638
                       552356789999**********999888......445567*********************************************776.4567 PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                       ++ +k+Er+ll++ i+++v  ++++     e+   Wr+ + ++GF+p+++s+++++qa++l+++++  g++ve+++ slvl+W++r+L+++Sa
  Thecc1EG005571t1 639 DALQKIERFLLQPGIEKIVLGRHRS----LERTPPWRSLFVQSGFSPLTFSNFTESQAECLVQRTPISGFHVEKRQSSLVLCWQRRELIAASA 727
                       999*****************99998....99999*********************************************************** PP

              GRAS 373 Wr 374
                       Wr
  Thecc1EG005571t1 728 WR 729
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.471345709IPR005202Transcription factor GRAS
PfamPF035144.6E-102372729IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MMKAMPQPFE EFQGKGALDF SSSTSSCSDS SLLLQNQHHQ QEEKWQSNNK EGCCYVGSEP  60
TSVLDTRRSP SPPTSSSTLS SSLGGSGGGG GGSGASTDTT GVAAIPAVSG NNNSQSVDIG  120
TEKCGLGMED WESVLSGSPS QEQSILTLIM GNIEDPSMGL NKILQSGAGS QDMEFNAGFG  180
LVDQGFAFES IASGGNLVSN NDPPLAGSCS DFTRLGTVST PTNPVFTSSP PNLLPTPLPP  240
GAFPPQQQQL QPLEALDEKP QIFNPQVIIN QNQAQFTQNP AMFLPLSYAQ LQEHHLLSPP  300
PPKRLNSGSS APNYQVPRVP FPGSGQEFYL RRQQQQLQML QQRPTTIGMA AAAKPKIVSD  360
ELANQQLQQA IIDLLIQAAE LIETGNLVLA QGILARLNHQ LSPVGKPFIR AAFYFKEALQ  420
LLLRLNTTNN TSALSTYNMI FKIGAYKSFS EISPIVQFAN FTCNQALLEV FEGCSRIHII  480
DFDIGYGGQW ASLMQELVLR NGGAPSLKIT AFSSPSTHDE LELGFTQDNL KHFASEINMA  540
FEIERMSLEA LSSGSWPLPL HLPENEAIAV NLPIGCFSNY PSTLPLVLRF VKQLSPKIVV  600
SLDRGCDRTD VSFPHHVVHA LQSYSGLLES LDAVNMNLDA LQKIERFLLQ PGIEKIVLGR  660
HRSLERTPPW RSLFVQSGFS PLTFSNFTES QAECLVQRTP ISGFHVEKRQ SSLVLCWQRR  720
ELIAASAWRC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3238972921375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007052139.10.0GRAS family transcription factor
TrEMBLA0A061DW610.0A0A061DW61_THECC; GRAS family transcription factor
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-148GRAS family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]